Följ Norrmejerier

Pressmeddelanden Visa alla 232 träffar

Världens längsta konstrunda – 160 mil runt Norrland

Världens längsta konstrunda – 160 mil runt Norrland

Pressmeddelanden   •   Jan 20, 2020 13:00 CET

Från Dundret i norr till Skuleberget i söder har sex norrländska riktmärken blivit utsmyckade med konst i storformat som hyllar Norrland. Tillsammans skapar de möjligen världens längsta konstrunda.

Norrländska konstnärer tolkar mjölkpaketet

Norrländska konstnärer tolkar mjölkpaketet

Pressmeddelanden   •   Jan 13, 2020 08:00 CET

För att hylla Norrland och den norrländska mjölken låter Norrmejerier fyra norrländska konstnärer gestalta ”Kärlek till Norrland” genom att skapa egna tolkningar av det finaste vardagsföremål vi kan tänka oss - mjölkpaketet. Verken, som är skapade av konstnärer från Luleå, Umeå och Örnsköldsvik, består av allt från digitala verk till akryl på canvas.

Norrmejerier och ICA presenterar ett svenskt (norrländskt) alternativ till halloumi

Norrmejerier och ICA presenterar ett svenskt (norrländskt) alternativ till halloumi

Pressmeddelanden   •   Dec 02, 2019 12:01 CET

​I en storsatsning på svensk livsmedelsproduktion och svenska lantbrukare kommer ICA lansera ett svenskt alternativ till halloumi. Produkten är skapad helt på mjölk från norrländska mjölkgårdar och tas fram av Norrmejerier. Produkten är det första storskaliga svenska alternativet till halloumi och ICA räknar med en försäljning på 350 ton årligen.

Västerbottensost® rekommenderas högt när svenska folket får välja

Västerbottensost® rekommenderas högt när svenska folket får välja

Pressmeddelanden   •   Nov 21, 2019 07:50 CET

Svenska folket rekommenderar gärna Västerbottensost® till andra. Det är undersökningsföretaget YouGov som rankat de varumärken som svenskarna helst rekommenderar och Västerbottensost® får en fin placering. Med på listan finns många välrenommerade varumärken.

Nyheter 3 träffar

Chokladboll efter träningen?  - Gainomax ® nya proteinbar med inspiration av svenskt fika!

Chokladboll efter träningen? - Gainomax ® nya proteinbar med inspiration av svenskt fika!

Nyheter   •   Jan 20, 2020 10:12 CET

Såhär i början av året förstärker Gainomax sitt barssortiment inspirerad av en uppskattad klassiker på det svenska fikabordet; en proteinbar med smak av chokladboll.

​Kjell Forsén, Bredbyn ny vice ordförande i Norrmejerier

​Kjell Forsén, Bredbyn ny vice ordförande i Norrmejerier

Nyheter   •   Maj 04, 2018 08:29 CEST

Efter konstituerande styrelsemöte har Ulla Bergström fortsatt förtroende som styrelseordförande och Kjell Forsén, Bredbyn, har utsetts till vice ordförande.

Johan Liljebäck, Överkalix, ny ledamot i Norrmejeriers styrelse

Johan Liljebäck, Överkalix, ny ledamot i Norrmejeriers styrelse

Nyheter   •   Maj 04, 2018 08:27 CEST

Johan Liljebäck, mjölkproducent i Svartbyn, Överkalix kommun är invald i Norrmejeriers styrelse. – Jätteroligt att Johan Liljebäck kommer in i styrelsen. Han representerar en yngre generation av mjölkbönder och med sin gedigna kompetens om företagande kommer han bidra till styrelsens arbete och Norrmejeriers utveckling, säger Ulla Bergström, ordförande Norrmejerier.

Bilder Visa alla 56 träffar

Gainomax Protein Bar Chokladboll
Gainomax Protein Bar Chokladboll - Förpackning
Gainomax Protein Bar Chokladboll
Jessica Arevärn

Jessica Arevärn

För att hylla Norrland och den norrländska mjölken låter Norrmejerier fyra norrländska konstnärer gestalta ”Kärlek till Norrland” genom a...

Licens Creative Commons erkännande, inga bearbetningar
Fotograf/Källa Pressbild
Ladda ner
Storlek

546 KB • 1125 x 1125 px

Videor 1 träff

Verum Filgoodfärgen

Verum Filgoodfärgen

Verum har sedan 1970-talet utvecklat mejeriprodukter utifrån filosofin att när magen mår bra, mår du bra, och då blir det lättare att lev...

Licens Creative Commons erkännande, inga bearbetningar
Ladda ner
Storlek

640 x 360 px

Dokument Visa alla 11 träffar

Faktablad: De norrländska konstnärerna som tolkar mjölkpaketet

För att hylla Norrland och den norrländska mjölken låter Norrmejerier fyra norrländska konstnärer gestalta ”Kärlek till Norrland” genom att skapa egna tolkningar av det finaste vardagsföremål vi kan tänka oss - mjölkpaketet. Verken, som är skapade av konstnärer från Luleå, Umeå och Örnsköldsvik, består av allt från digitala verk till akryl på canvas.

Recept_Mjölk_Linnéa Liljedahl_Norrmejerier

Recept_Mjölk_Linnéa Liljedahl_Norrmejerier

Dokument   •   2019-06-19 09:30 CEST

Restaurangen Mjölk har turnerat i form av unika gästspel på kända krogar i norra Sverige – och nu delar Linnéa och Norrmejerier med sig av alla recepten och tips på hur man kan skapa riktig gourmetmat, där den norrländska mjölken står i centrum.

Bakgrundsfakta Norrmejeriers stimulanspaket

Bakgrundsfakta Norrmejeriers stimulanspaket

Dokument   •   2015-03-02 09:00 CET

Norrmejerier har undersökt svenskarnas inställning till lokalproducerad mat

Undersökningen genomfördes av HUI Research 2012. Totalt besvarades enkäten av 1 554 personer i åldern 16-64 år. Ange källa ”Norrmejerier” när ni refererar till undersökningen.

Kontaktpersoner 4 träffar

  • Brand & Product Manager Norrmejerier
  • varumärke, produkt och marknadsföring
  • hayannusa.uwhauorddrelohl@ianodmrriqmelrjelgrifserhh.srbejb
  • +46701843103

  • Produktchef Västerbottensost®
  • Västerbottensost®
  • Lizonavf.Jfbonjpssavonxg@ndforobrmtaejljercviecqr.ljsexa
  • 076-136 33 01

  • Presskontakt
  • Kommunikationschef
  • krzoiszwtiqnnade.snvtiyaerrcnsappegmtzho@nvuorburmdwejuneroeieiwr.uesevr
  • 0730616433
  • 090182997

  • Digital Marketing Manager
  • erxoikws.hipildhlbnvomva@nynorztrmtnejwoerjgiehvr.avselk
  • 070-6743191